SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003519 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003519
Domain Number 1 Region: 176-359
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-55
Family Nuclear receptor ligand-binding domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-26
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003519   Gene: ENSMPUG00000003549   Transcript: ENSMPUT00000003586
Sequence length 366
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:2173472:2190159:1 gene:ENSMPUG00000003549 transcript:ENSMPUT00000003586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLPGEAPEIREEEEKKEVAEAEGTPELNGGPERSLPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCVALGMSHNAIRFGRMPEAEKRKLVAGLTASEGNQHNPQVADLKAFSK
HIYNAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQYTTVETVRELTEFAKSIPSFSNLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGG
PGIILY
Download sequence
Identical sequences M3XWR9
ENSMPUP00000003519 ENSMPUP00000003519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]