SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003520 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003520
Domain Number 1 Region: 269-428
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-45
Family Nuclear receptor ligand-binding domain 0.00000248
Further Details:      
 
Domain Number 2 Region: 28-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003520   Gene: ENSMPUG00000003550   Transcript: ENSMPUT00000003587
Sequence length 492
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:492830:512975:1 gene:ENSMPUG00000003550 transcript:ENSMPUT00000003587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGPQRQHRASQELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CHVVYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQRQQQQQRGQVAKTPPAGGQEADPLACPIGLPDGQLPQGSSPDLPEAAACPPGLLRAP
GSLSSYPSSLAKAGPDGASYHLEYSPERGKAETGKGFYSTGSQLSPDRCGLRFEDAGHPG
LEEPGQGPDSYCSLSFHSAPEGPYASLTETEHLVQNVCKSYRETCQLRLEDLLRQRPNIF
SREEVAGYQTKSMWEMWERCAHRLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNHTVFFEGKYGGMELFRALGCSELISSIFDFSRSLSSLRFSEDEIALY
TALVLINASECRWACLRDMQVAGVRQMLKGLDLQMRLNLGNGFKEQRADFRGASGRETPS
KVGLEKWGAGEP
Download sequence
Identical sequences M3XWS0
ENSMPUP00000003520 ENSMPUP00000003520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]