SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003522 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003522
Domain Number 1 Region: 759-986
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-60
Family DBL homology domain (DH-domain) 0.00000000132
Further Details:      
 
Domain Number 2 Region: 354-531
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-54
Family Regulator of G-protein signaling, RGS 0.00000005
Further Details:      
 
Domain Number 3 Region: 990-1124
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-42
Family Pleckstrin-homology domain (PH domain) 0.000000368
Further Details:      
 
Domain Number 4 Region: 39-125
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-21
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003522
Domain Number - Region: 153-163
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00471
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003522   Gene: ENSMPUG00000003552   Transcript: ENSMPUT00000003589
Sequence length 1536
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897177.1:234947:312605:1 gene:ENSMPUG00000003552 transcript:ENSMPUT00000003589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDSPTAAWLSSLSLGDPAPERRSPSHRRQPSDASETAGLVQRCVIIQKDQHG
FGFTVSGDRIVLVQSVRPGGAAMRAGVQEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVA
LTLLGSSPSPVGVSGLQQDPAPTGAPRATPVVPPPPPPPPLPPPQRITGPRPLQDPEFQK
HAAQILRSMLRQEERELQRICEVYSRNPASPLEEQIEGARRRVTQLQLKIQQEMGSGGVD
APLPCGDASQRASEGQLSLDSQEGDSGLDSGTERFPSLNEALLSRNSALSDPGLDSPRTS
PVVMARLAQHHRRQASDTPVPGASDQGTDQSPKPLIIGPEEDYDPGYFNNESDSVFQDLE
KLKARPAHLAVFLRYIFSQADPSPLLFYLCTEVYQQTHPKDSRTLGKDIWNIFLEKNAPL
RVKVPEALQAEIDLRLRTGEDARIALREAQEAAMPEIQEQIQDYRAKRTLGLGSLYGEND
LLGLDGDPVRERQVAEKQLAALADILSKYEEDRSAPMDFALNAYMSHAGLRLREARPSSA
AEKAQAAPDKDKWLPFFPKTKKSSNSKKDKDALEDKRRNPILKYIGKPKSSSQSTFHIPL
SPVEVKPGNVRNIIQHFENNQPYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESL
KGREEMKRSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKM
GRRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLSQREIDR
QEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEA
MRKLREEGPIVKDIGDLMLARFDGPAREELQQVAAQFCSCQTAALGLIKAKQRKESRFQL
FMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESVLKHTEGGTPEYEKLCRARDQCRE
ILKYVNEAVKQTENRHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARRMVHEGPLSWR
ISKDKSLDLHVLLLEDLLVLLQRQDEKLLLKCHSKTAAGSSDSKQTFSPVLKLNAVLVRS
VATDKRAFFVICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRRPGGAPALAHPP
PPGTQAPAQQSPTPSRVQLDGSEVFHSEPEELPGAGPGPQQRARGTHPVLPEDSEREGSL
EEELGALPHPSTSADGEHRGGRTRDPILLPLPGPLFTEGLADSALEDVESLRHLILESLL
QGQRPEDDLTPTPSLGSSTCHPADPGSPGHGLLGVEEPEQGDAALRSLEQLPPRARNSGI
WESPELDRNPEEEAPSAEATGRYQVVRKAGGGTDAAEVAGSKARLPESGRSGPEPPDVEG
GAEAAGNCFYVSMLAGPPDSSTEPSQPDSLPAWQPWGSRGGRRRPSHSAPSLALRDVGSI
FHTIEQLTVKLNRLKDVELAHRELLRSLAGESGGTTPVGSFHTEAAGWTDSSLSPPARET
LASDSRDSHQPGPCSEDGSDTALEDGTALTASSPGL
Download sequence
Identical sequences M3XWS2
XP_004778518.1.14098 ENSMPUP00000003522 ENSMPUP00000003522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]