SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003580 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003580
Domain Number 1 Region: 284-419
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.55e-32
Family Synaptotagmin-like (S variant) 0.00021
Further Details:      
 
Domain Number 2 Region: 153-279
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.99e-17
Family Synaptotagmin-like (S variant) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003580   Gene: ENSMPUG00000003609   Transcript: ENSMPUT00000003647
Sequence length 421
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4630273:4650392:1 gene:ENSMPUG00000003609 transcript:ENSMPUT00000003647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMDVAEYHLSVIKSPPGWEVGVYTAGALALLGIAAVSLWKLWTSGSFPSPSPFPNYDYR
YLQQKYGETYAEAKQKRVPAWNAPRASMRGSPSRKGSLSIEDTFETISELGPLELMGREL
DLAPYGTLHKSQSADSLNSISSVSNTFGQDFTLGQVEVRMDYDAASHTLHVAVLQGKDLL
EREEAGFESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPAALEEKSLRFSVF
GIDEDERKVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADAVGEILLSLSYLPTAERL
TVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVPA
IVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLATLRRPVSMWHPVRR
N
Download sequence
Identical sequences M3XWY0
ENSMPUP00000003580 XP_004759545.1.14098 XP_004759546.1.14098 ENSMPUP00000003580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]