SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003602 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003602
Domain Number 1 Region: 154-270
Classification Level Classification E-value
Superfamily PX domain 3.66e-25
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 39-137
Classification Level Classification E-value
Superfamily PDZ domain-like 1.14e-24
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 3 Region: 274-343
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000136
Family Ubiquitin-related 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003602   Gene: ENSMPUG00000003631   Transcript: ENSMPUT00000003669
Sequence length 566
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:613686:676222:-1 gene:ENSMPUG00000003631 transcript:ENSMPUT00000003669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCTGNGGGGGGGPRVVRIVKSESGYGFNVRGQ
VSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDL
IRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKF
VVYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLE
EYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGTTVTVRVKKNSTTDQV
YQAIAAKVGMDSTTVNYFALFEVINHSFAVRKLAPNEFPHKLYVQNYTSAVPGTCLTIRK
WLFTTEEEILLNDNDLAVTYFFHQVGDYLKKSFKKDIEDSSYLYTLCKSLEFLRYLNMLR
TCEGYNEIIFPHCACDSRRKGHVITAISIMHFKLHACTEEGQLENQVIAFEWDEMQRWDT
DEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEVIEEEEANQIES
CSHTFFSSFLRNIFQMARSQQRDVAT
Download sequence
Identical sequences M3XX02
ENSMPUP00000003602 ENSMPUP00000003602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]