SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003605 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003605
Domain Number 1 Region: 275-587
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.61e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0062
Further Details:      
 
Domain Number 2 Region: 156-253
Classification Level Classification E-value
Superfamily ISP domain 1.83e-26
Family Rieske iron-sulfur protein (ISP) 0.028
Further Details:      
 
Domain Number 3 Region: 591-669
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.14e-20
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003605   Gene: ENSMPUG00000003634   Transcript: ENSMPUT00000003672
Sequence length 690
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:2228116:2239163:1 gene:ENSMPUG00000003634 transcript:ENSMPUT00000003672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCASSRSAPPPPLPPSISISLRLSPQPPSKPWSLQMPLVSPAGPGGSSSISKGHGESSPT
SGGTLGLPQPTICVPAPPISCGPFAMGGCFSKPKPVELKIEVVLPEKERGKEELSASGKG
SPRAYQGNGTARHFHAEERLTAPHPYPGPQDCVEAAVCHVKDLENGQMREVELGWGKVLL
VKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQ
VKIEKEKVYVRASKQALQLQRRTKMMAKCISTSAGHSSSTNVLIVGAGAAGLVCAETLRQ
EGFSDRIVLCTLDRHLPYDRPKLSKSLDAQPEQLALRPKEFFRAYGIEVLTEAQVVTVDV
RNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNA
VVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQT
EVSELRAQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSSVNLDSRGFIPVNKMM
QTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEISTVPYLWT
AMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLA
SGRAIRKREVELFVLHSKTGDMSWLTGKGS
Download sequence
Identical sequences M3XX05
ENSMPUP00000003605 ENSMPUP00000003605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]