SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003614 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003614
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 2.22e-16
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003614   Gene: ENSMPUG00000003643   Transcript: ENSMPUT00000003681
Sequence length 283
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:12096360:12098282:1 gene:ENSMPUG00000003643 transcript:ENSMPUT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPPPPGPGGPQ
HAPFAPPPPLVPIPGGAAPPPGGAPCKLGSPAGEAAKVFGGFQVVPAPDGQFAFLIPNGA
FAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Download sequence
Identical sequences M3XX14
ENSMPUP00000003614 ENSMPUP00000003614 XP_004745345.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]