SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003622 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003622
Domain Number 1 Region: 480-824
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 8.76e-116
Family Rap/Ran-GAP 0.000000527
Further Details:      
 
Domain Number 2 Region: 953-1027
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000133
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003622
Domain Number - Region: 1696-1764
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003622   Gene: ENSMPUG00000003651   Transcript: ENSMPUT00000003689
Sequence length 1784
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896944.1:11054130:11190007:1 gene:ENSMPUG00000003651 transcript:ENSMPUT00000003689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLKRSQTERPAAPERASVVATDGAPKVHTDDFYMRRFRSQNGSLGSSVMAPVGPPRSE
GSHHITSTPGVPKMGVRARIADWPPRKENVKESSRSSQEIETSSCLESLSSKSSPVSQGS
SVSLNSSDSAMLKSIQNTLKNKTRPAESMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECVSPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTP
TKLSDFLIAGGGKGSGFSLDVIDGPISQRDNLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLSMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESASFESTLSSHCTNAGVAVLEVPKDGLVLHLDRVKRY
IVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPEETKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVIPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGVMYCRAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRVHNPCTDGVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAKDYNKAMEMDCLLGVSNEFIVLIEQETKSVVFNCS
CRDVIGWTSTDTSLKIFYERGECVSVESLINNEDIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEFKFPFRNNNKWQRNANKGTHSPQ
VPSQVQSPMTSRLSAGKGDGKMPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMA
LARSQPCRNSPSNLSSSSETGSGGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGSGK
STPSWQRSEDSIADQMEPTCHLPAVSKVLPAFRESPSGRLMRQDPVVHLSPNKQGHSDSH
YSSHSSSNTLSSNASSAHSDEKWFDGDRTESELNSYNYLQGTSADSGIDTTSYGPSHGST
ASLGAATSSPRSGPGKEKVAPLWHSSSEVISLADRTLETESLGMERKAESSLSLDIHSKS
QAGSNPLTRENSTFSINDAASHTSTMSSRHSASPVVFTSARSSPKEELHPATSQLAPSFP
SSSSSSSSGPRTFYPRQGATSKYLIGWKKPEGTINSVGFMDTRKRHQSDGNEMAHTRLRA
STRDLRASPKPASKSTIEEDLKKLIDLESPTPESQKNFKFQALSSPQSPFPATPTARRAL
HRTLSDESIYSGQREHFFASRASLLDQALPNDVLFSSTYPSLPKSLPLRRPSYTLGMKSL
HGEFSASDSSLTDVQETRRPPMPDPGLMPLPDAAADLDWSNLVDAAKAYEVQRASFFAAT
DEGHRPLSAASNSDQLEEQALAQMKSYSSSKDSSPTLASKVDQLEGMLKMLREDLKKEKE
DKAHLQAEVQHLREDNLRLQEESQNASDKLKKFTEWVFNTIDMS
Download sequence
Identical sequences M3XX22
ENSMPUP00000003622 XP_012912910.1.14098 ENSMPUP00000003622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]