SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003644 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003644
Domain Number 1 Region: 35-158
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-40
Family Phosphotyrosine-binding domain (PTB) 0.00043
Further Details:      
 
Domain Number 2 Region: 449-532
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-18
Family SH3-domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003644
Domain Number - Region: 582-634
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00419
Family SAM (sterile alpha motif) domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003644   Gene: ENSMPUG00000003673   Transcript: ENSMPUT00000003711
Sequence length 645
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897048.1:1110612:1121016:-1 gene:ENSMPUG00000003673 transcript:ENSMPUT00000003711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWESSHCASMSRPSSRAIYLQRKDYVQAISSEPTCLQHRVEHLMTCKLGTHKVQDPRDAL
RKLQEMDAQGRVWSQDLLLQVRDGWLQLLDIETKEELDSYRLDSIQAMDTALNTCSYNSI
LSITVQESGLPATSTLLFQCQEVGAEQLRTGLQRALEEEQQQSRPPSGAHRPSQDRWRGP
PLERSFPKEQAPPLEKGSPPEQPYWMTAGCSAPPSPRPLARNSSVRELGTFTLPPPLRPP
SPENLERDEEILNHVLRDIELFTGKLKETQGMNNHKKKRLGKKKGKNQWVMTQAQYTDCF
QKIKYSFNLLGKLATWMQEGNAPEFVHILFQLLDSILAHCPEPGLATQVISPLLTPKAID
LLQSCLSPAETDFWKRLGVAWTTSRADWTGVEPPPYQPTFSDGWQLPEPSSQVRGASQSA
LLKALFSCSFLPSQSKPQSHDNDIWSLAPPSKPALKMQVLYEFEARNPQELTVAQEEVLE
VLDQSKRWWLVKNEKGQTGYIPSNILEPLQSGASRSQSQSPSRVPPGLDYPETISRGWKP
GGFNDKLTTCQVYHGARAENKPCPHQRSKPWSEAPMLRLSSTPEEVRAWLQAENFSTITV
KSLRFLTGSQLLHLRPGELQMLCPQEAPRVLARLDAVRRMLGVSH
Download sequence
Identical sequences M3XX44
ENSMPUP00000003644 ENSMPUP00000003644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]