SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003653 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003653
Domain Number 1 Region: 390-570
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.8e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.038
Further Details:      
 
Domain Number 2 Region: 257-356
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000392
Family WWE domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003653
Domain Number - Region: 68-91
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00053
Family CCCH zinc finger 0.0054
Further Details:      
 
Domain Number - Region: 186-223
Classification Level Classification E-value
Superfamily WWE domain 0.0222
Family WWE domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003653   Gene: ENSMPUG00000003682   Transcript: ENSMPUT00000003720
Sequence length 593
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:1840285:1880680:1 gene:ENSMPUG00000003682 transcript:ENSMPUT00000003720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNCRNNHSLTTDHNLSVLRTHGVDHLSYSELCQLLFQNDPWLLPEICLHYNKGDGPYGSC
SFQKQCIKLHICQYFLQGECKFGTSCKRSHDISNAENLEKLERLGMSSDLVSRLPSIYRN
AHDIKNRSSTTSRGHPPTLGPQGTSERRDSSGSVSPNTSNQEESDQICLYHIRKSCSFQD
KCNKVHFHLPYRWQFLDRGKWKDLDKMELIEEAYSNPRKDRILCAESASNFHFDCLDFES
MMFGAAPARRLSTASSVTKPPHFILTTDWVWYWTDEFGSWQEYGQQGLEHPVTTVSSSDL
EKAYLAYCAPGSDAQAAVLKFQAGKHKYELDFKVFVQKNLVYGTVRKVCRRPRFVSPQEV
KVKQACSVKFQGPKSIPDHWDPSALPDPGFKKITLSSSSDEYQKVWSLFNRTLPFYFVQK
IERVQNLALWEVYQWQKGQMQKRNGGKVVDERQLFHGTSANFVDAICQQNFDWRVCGLHG
TSYGKGSYFARDAAYSHHYSKSDTKLHTMFLARVLVGEFIRGNASFVRPPAKEGLGNVFY
DSCVNSMSDPSIFVVFEKHQVYPEYVIQYTGSTKPTTGASALFSLASFFGGRQ
Download sequence
Identical sequences M3XX53
ENSMPUP00000003653 ENSMPUP00000003653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]