SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003673 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003673
Domain Number 1 Region: 145-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-86
Family Protein kinases, catalytic subunit 0.00000000000276
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.47e-37
Family Regulator of G-protein signaling, RGS 0.0000000845
Further Details:      
 
Domain Number 3 Region: 512-622
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003673   Gene: ENSMPUG00000003703   Transcript: ENSMPUT00000003741
Sequence length 647
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4826366:4835843:1 gene:ENSMPUG00000003703 transcript:ENSMPUT00000003741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERL
ARSREVFDTYIMKELLACSHPFSKSATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVF
QKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCL
DKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYH
LSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDF
SKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEI
DRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVF
LQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVA
ETVFDTINAETDRMEARKKTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFY
LFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQ
WKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Download sequence
Identical sequences M3XX73
XP_004759550.1.14098 ENSMPUP00000003673 ENSMPUP00000003673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]