SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003774 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003774
Domain Number 1 Region: 858-1021
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.93e-30
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.04
Further Details:      
 
Domain Number 2 Region: 725-809
Classification Level Classification E-value
Superfamily WWE domain 0.000000000131
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003774   Gene: ENSMPUG00000003805   Transcript: ENSMPUT00000003843
Sequence length 1024
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:2602396:2658227:1 gene:ENSMPUG00000003805 transcript:ENSMPUT00000003843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPEVCCFITKVLCAHGGRMALDALLEEIRLPEGQLLEVLEEAGPDRFVLLETGGREGI
TRSVVATTGARVCRRKFCQRPCEDLHLCKLNLLGRCNYTQTDRNLCKYSHNVLSEENFKV
LKNHELSGLNQKELAVLLLQSDPFFMPEICKNYKGEGRKVTCNKYPQCERLHICEHFTRG
NCGYPNCLRSHNLMDRRVLAIMREHGLSSSVVQNIQDICNSKHSPKKHSGHRGPPAYRRD
PAYRGRSKSRDRSFHGSMEFLPSASASTQKSCAAAADQIGHRLPQEDVPVEDLAHKFVHL
GSQDGPQPSPVPPQMDHVRGRSQVGRSQRFSENGSPKDLFYGNQGSVYLPSDSKPASSQK
GPASSLNGKGTGRESLFSQSQAASGSPPGSPQTPDAMTAWKNTGLLSSDGVNAGGRSGKQ
NVQYGPLFNNNVDGTAADTTSTRSFSYKTATSGQREKSLPRSQDARTTHGNVQTTGKVAG
GDDPAVASVNGPCREKTVWANHSVHGTPDSSSQVADETFRVSKTGAAGFDFTLPSRGDKN
ASCFGSQNLEGEVVPTPWETTVPTPQVRTPSKVPSSTSSSSDKSAVYASHGQNSAPVLVS
PASELARTPRYPPYFASDVESTSSSRMADCGSKEICLDHLCRGCQVESCNKVHFHLPYRW
QMWLGNTWMDFQPMETIEKAYCDPQIHTFSIGDKDIDFQKMTCNFNPIRRISTPSSVIVL
TNFVFATRWIWYWKSQSDKWVEYGEEADSHQASSIDSSYLESFFLGHPRGVVAFHVGSQN
YELSFAGMIQTNVASRTQKRVVRRPKFMSYKDVEQIKSGFSYQLAPPRSDPLSPALLPQW
DFGSDGYELSDIPCRVLEYIKIDTYFKASMKNFKVERIRKIKNTKLLSAFERKKMKMNNR
KEEILFYATDHVHLDSICRDNFDWLLHGAGKPKYGKGIYFTKDAIHAHKNCQCDTKNIVM
FVARVLVGDFTQGEMGSISPPPPPYNSYVDIRSNPSVFVIFDKDQIYPEYVIEYTELDKG
CVIS
Download sequence
Identical sequences M3XXH4
XP_004741733.1.14098 ENSMPUP00000003774 ENSMPUP00000003774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]