SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003801 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003801
Domain Number 1 Region: 601-638
Classification Level Classification E-value
Superfamily WW domain 0.000000132
Family WW domain 0.0042
Further Details:      
 
Domain Number 2 Region: 222-258
Classification Level Classification E-value
Superfamily WW domain 0.000000223
Family WW domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003801
Domain Number - Region: 732-742
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 814-875
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00929
Family Adhesin YadA, collagen-binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003801   Gene: ENSMPUG00000003831   Transcript: ENSMPUT00000003870
Sequence length 1028
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:559999:602758:1 gene:ENSMPUG00000003831 transcript:ENSMPUT00000003870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKSRAVPGRRPILQLSPPGPRSNTPGRDPEPEPDTEPDSTVAAPSQPAPAAPPPPPPP
TTTTTVTAAAAAAAAPDDSPSESKDEQEVVVEVPRVPNPPKPVMTTRPTAVKATGGLCLL
GAYADSDDDESDVSEKPAQSKEANGNQSADIDSTLANFLAEIDAITAPQPAAPVGASAPP
PTPPRPEPKESATSALSSTTSNGTDSAQTAGWQYDTQCSLAGVGIEMGDWQEVWDENTGC
YYYWNTQTNEVTWELPQYLATQVQGIQHYQPSSVTGAEANFVVNTDVYTKEKNVSVSSSK
SGPVVAKREVKKEVNEGIQALSNSEEEKKGVAASLLAPLLPEGIKEEEERWRRKVICKEA
EPVTEVKETSTTAEEAATIVKPQEITLDNMEDPSQEDLCSVVQSGESEEEEEQDTLELEL
VLERKKAELRALEEGDGSVSGSSPCSDISQPASQDGMRRLMSKRGKWKMFVRATSPESTS
RSSSKTGRETPENGETVTGADTSEKTDENSDKEMEVEESPEKIKAQTAPKEEEQDLKFQI
GELANTLTSKFEFLGINRQSISNFHVLLLQTETRIADWREGALNGNYLKRKLQDAAEQLK
QYEINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGEEEEEESQAQESRDETLPKQT
SKDKTGTESNSAESSENSTGSLCKESFSGQVSSSSLMPLTPFWTLLQSNVPVLQPPLPLE
MPPPPPPPPESPPPPPPPPPPVEDGEIQEVEMEDEGSEEPPAPGTEEDTPLKPSTQTTVV
TSQSSVDSTVSSSPSTKAVKRKATEISTAVVQRSATIGSSPVLYSQSAIAAGHQAAGIGH
QSAGIGHQALSVSHPATGMGHQARGMSLQSNYLGLASASAIMSYTECSVPMAVTAPTLQP
VQARGAVPTTAIIEPPPPPPPPPPPPPPPAPKVPPPEKTKKGKKDKAKKSKTKMPSLVKK
WQSIQRELDEEENSSSSEEDRESTAQKRIEEWKQQQLVSGMAERNANFEALPEDWRARLK
RRKMAPNT
Download sequence
Identical sequences M3XXK1
XP_012917222.1.14098 ENSMPUP00000003801 ENSMPUP00000003801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]