SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003836 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003836
Domain Number 1 Region: 995-1099
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-30
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 1122-1223
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-20
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 3 Region: 903-993
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003836   Gene: ENSMPUG00000003866   Transcript: ENSMPUT00000003905
Sequence length 1244
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897044.1:4544999:4654536:-1 gene:ENSMPUG00000003866 transcript:ENSMPUT00000003905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPSSLGVPQPDNQAYQKNIKDLEKEVKGDTPKAVLHPTKALGKSKGNGDEHTSASMNGK
ENSPFLPKDNKQLSPDSKISREKENDHLLPSISHQRDEVLTASMFNACEESLSGKITLQD
FPDTVEALKPTKGKIITEVKCGAFSMQVEIKNRFFCKTEMQFPTKRRCPICRQHYFSRHI
QKWYTSRSCSSRCRNVLVEELKPEEASKSEGIARMERPSLKVSIVEKGIKVKYMSKKQNI
LINITHPKRKGKTAKYKNISSNHTTKESSRSSAPSEIRHPEKWQLENKHQSSEGLPVSPP
IVFAVQKEKNIDTAVDFLCSTPEREKNNPDTISPVLDHREVESAISQQEDFKISQSTLKK
KPFSEAKAPLKNILPTLQDTLKTTGLREMDLQKMSFEDPKDVDQETKVIFDMPEDIISDL
CIRRSTEEMNYLPSAMTGTFPVQGGKDSAFRSLSSPSMQLVGEKAADIYYKGSKIPLADC
CEKSTSLPLPSSQNVLRSSTSFGPSPWATRHSEPKEIPGDTFSFDHCVESLKNCEEEHVD
VTDRDFHKATLHSDSCTTEEQLLEMKSTQCSTLSPASFSSLSAGSPLNGSSHSTVEWGPA
KSQASHPETAALSTTTELVMSLVSDALEQRLIIQNDKEGMVYSNCPMGMKTPEDSCNSLG
NDEKDKFQVMPVVKDACHRDFEDLSNENHDEVGFPMDFPNTAEFSCTACATDKLFVIEKT
LTNDADQYGNQDEKGLGLTSFKQEPTECQRIASTKPNSEGDRNDPKETYYHQIDVLLSPQ
KQKALADWNLEINSLRKLSQEWAPRGTRVSDGSQEEAIDQWARRRQQFKDGKRCSSAGGS
SFTSNITEGSITSEDGCSVDLGFGVDLEEKGFYTENFHSAAWVFRGDDGNPEDSPRCLSK
KPRPVAVRERTVRLFKGTGDYPWGFRIQFSKPIVVTEVDANSAAEEAGLQIGDVVLAVNG
TEVTSAEHAEAVHLARKGPDILTLVVGSDISRCPNTPRPTCRGYLHKRTHSGFVKGWRKR
WFVLKHDGCLHYYRHKKDEGKCSPLEVIKLEGAEVGMDSSLGKPFVFNCTPQSGNRTFCF
CATSNQEMKRWLQAMDKAAHPVRQTHVWEDVTLHNSSLPPLAIKNPECLGLLHQSDGSTD
RWVQHYCILKDGCLYFYASIRSTQASGGLYLQGYKVNEQTLSFKQSVIELEPPSEEFKTF
YFCAENKTENQRWIMALKASIKKWVPLHQAIQDFMNRPLEETRM
Download sequence
Identical sequences M3XXN6
ENSMPUP00000003836 ENSMPUP00000003836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]