SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003842 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000003842
Domain Number - Region: 144-184
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.018
Family Cdc48 domain 2-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003842   Gene: ENSMPUG00000003872   Transcript: ENSMPUT00000003911
Sequence length 307
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:2997120:3025479:-1 gene:ENSMPUG00000003872 transcript:ENSMPUT00000003911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLN
ITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVA
TYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAV
SIIECDMNVDFDAPLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKK
GVEPSPSPVKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFVAFSGEGQSL
RKKGRKP
Download sequence
Identical sequences M3XXP2
ENSMPUP00000003842 XP_004742657.1.14098 ENSMPUP00000003842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]