SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003870 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003870
Domain Number 1 Region: 2-182
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.36e-73
Family T-box 0.000000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003870   Gene: ENSMPUG00000003900   Transcript: ENSMPUT00000003939
Sequence length 249
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:3232262:3243479:1 gene:ENSMPUG00000003900 transcript:ENSMPUT00000003939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALWDEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFH
SSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMH
RYQPRFHVVYVDPRKDSEKYAEENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGF
RDCDPEDWPRNHRPGALPLMSAFARSRNPVASPTQPNGAEKAFSCVKSEPNPLPLRPPPV
CCPQLTEQP
Download sequence
Identical sequences M3XXR9
ENSMPUP00000003870 ENSMPUP00000003870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]