SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003889 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003889
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily SH3-domain 9.51e-16
Family SH3-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003889   Gene: ENSMPUG00000003920   Transcript: ENSMPUT00000003959
Sequence length 1775
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896927.1:4040060:4103232:-1 gene:ENSMPUG00000003920 transcript:ENSMPUT00000003959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRGEALEDFTGPDCRFVSFKKGDPVYVYYKLAGRPPEVWAGSVGRVFGYFPRDLIQVVY
EYTKEELQVPADETDFVCFDGGRDDFDNYNTEELLGFLELSSSATGDSEKGIEKPQHGDT
PPEAFEESDIEPEPEEVNSEESESVFSENTKELKERSGSQKNHPHVNSQAGHIQGDPTSF
EPFEEMLQDKLKVPESENNKTSNGSQVSSEQEKIDAYKLLKKEMTLDLKTKFGSTADALV
SDDETTRLVTSLEDDFDEELDTEYYTVAKEEEENFDELLLLTFTHGEEDVKPPATSGVEN
YSAEREQRPDEEDKVEAAQPPGIKNYEENVATDWEDIILPFTEGDRQTGVDSGSSDSEEG
DDGSIPGSESGKSRSATESVDPKKAEDSLLTVDVPKTNNDKDPEIHITEKGRNIEESKRG
LAQAEEGLEEQKQEGMTSHSSPQSSHPGSLPAAGGGREVLASAFDNKENDLKGAAVHISK
GMLREEKPGEQILGGGSEHEPKPEASESQVNEEKPGQADLGVAPLLGGHQRNASRDKVEE
VPVLAGGPQPHTLSVDHPSEEFKEKQLPQTQDQPRPSPLDEMGLPRELEEEGPLGQRNLS
RPQGKEAAAHKQTGEERRLSGDKAQEGSSGEEVAPYKPEAGSLEVEATSQTESPQGPGVH
TERPKAEDDDSPEELLEDENALSAKQSKEKSPEIQGRPLDVNPPGAVVGAINPDAETEGS
KEETGNTLEIERQSETLGSRADPGGRAAETESPPGARKAQRASEGSDSSDKQNQTLELGE
MFQNQGTDDFKEDHADESTRKPGVGELSEEDQEDLEGFVDTESQGTSAEEHEGDWPPRAP
GTHTPARSDDVEDLPVIGSFFKDQQSLQRLRKYFDVHELEAMFHEMASRLKSAQQESLPY
NVEKVLDKVFRASESHILSTAEKMLDARVTESRDLGMKDSDVFEEAAVLDDVQDLIYFVR
YKHSAVEEKDPPTTAQLPPEGWGGSMEGRQPHLEDNFPQDNPEDNFPQDNAEDLKVQILK
EPSQLDQPVTGDKGGPDVSQEPNTEKDIDRGIITTESSPVDAVDAKKQLETNAEEPASVT
PLENAILLIYSFIFYLTKTLVATLPDDVQPGPDFYGLPWKPVLITAFLGIGSFAVFFWRT
VLAVKSRVYQVTEQQIAAKVKNIMKENAELVQKLSNYEQKIKESKKHVQETKKQNMILSD
EAIKYKDTIKKLEETNGILDNTAKNLRVMLESEREQNVKNQDLISENKKSIERLKDVISV
NASEFSEVQIALNEAKLSEEKVKSECHRIKEENAKLKKKKEQLQQEIKDWSKSHAELSDQ
IKAFEKSQKNLEVALSHKDDNINALTNCITQLNQLDCESESEGQNKGGSELDELANGEVG
GDQSEKVKNQIKQMMDISRTQTAVSVVEEDLKLLQVKLRASMSTKCNLEDQIKKLEDDRN
SLQSTKAILEDECQTLRQKVEILNELYQEKEMALQKKLSQEEYERQEREQRLSAADEKAL
LAVEEVKMYKRRIAEMEEELLKTERSFKTQIATHEKKAHDNWLKARAAERAITEEKREAA
NLRHKLLELSQKMAALQEEPVIVKPRPGRPNTQNPPWRGPLSQNGSFGPSPVSGGECSPP
LTAEPPARPLSATLNRREMPRGEFGSADGPLPRPRWSSEASGKPSASDPGSGAAPMMNSS
SRGSSPTKMMDEGKVTVAARGPPPFPGVPLMSSPMGGPVPPPIRYGPPPQICGPFGPRPF
PPPFGPALLHTLDRILRIRKSTKKLSTANAHVSYK
Download sequence
Identical sequences M3XXT8
ENSMPUP00000003889 ENSMPUP00000003889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]