SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003930 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003930
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.54e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 2 Region: 130-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003930
Domain Number - Region: 653-744
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.085
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003930   Gene: ENSMPUG00000003961   Transcript: ENSMPUT00000004000
Sequence length 759
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897189.1:1454214:1506033:-1 gene:ENSMPUG00000003961 transcript:ENSMPUT00000004000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRLRSSEVCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLIEIQYELTDRLAFYLCGRRPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
PLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLEATASKANRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKILQLMKVNNNLSDELRIMQKKLQTLQSENLNLRKQAT
TNIYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEVNHPEESRTR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESTRRASRLEKQNSTPESDYDNTPNDTD
PDDTGSGRKGRQRSMVWQGDGSVPDTAEPHTAPSPILPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDTVRTSLRLLTSSAYRLQSECKKTLPG
EPGLPTDIQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences M3XXX9
ENSMPUP00000003930 ENSMPUP00000003930 XP_004779189.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]