SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003932 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003932
Domain Number 1 Region: 232-332
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-30
Family Phosphotyrosine-binding domain (PTB) 0.0000162
Further Details:      
 
Domain Number 2 Region: 78-197
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-17
Family Phosphotyrosine-binding domain (PTB) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003932   Gene: ENSMPUG00000003964   Transcript: ENSMPUT00000004003
Sequence length 1259
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897040.1:2308335:2325452:-1 gene:ENSMPUG00000003964 transcript:ENSMPUT00000004003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSFARDQATRRLRAAAAATAAAISAVGTTPLLSSGIPTALIGTGSSCPGAMWLSTAT
SSRSDSESDEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAVPALIPPRRVITLYQCFSVSQRADAKYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCRTPGALPDGEPARPAAAAAAAEPPFYKDVWQVIV
KPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRS
TVIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYTISIGAHLLNLLSARR
HLDTLPREPSGWLRRSRFEQFYHFRAIGDREDEMPLTRRYLTPSEPVPTSRRARLHLPRA
RRSRRAISVPPSYFRRLPSSPVRVLYPAEVPNHRAGLSPEASGSGNSGEEDSPQGQEAQE
GNGGDYMPMNRWGSGNGQGSGSGQGSSGQGSSSQGSGGSQCSGGGPGSSGGQGSGSQGAG
GNQRSGDGQSTAGGQGSGSGQGASGGGHGSSGGRGPGDGHGSGGGKSHGGGKGSGSGKIS
EGNGERGKSLKKRSYFGKLTQSKQHMPPPPPPPPPAGATGSKGKSGGRFRLYFCADRGTP
KERKEAKELKDLETLEGAAQGPHRARAFDEDEDDPYVPMRPGVAAPPPSSSDYMPMAPQN
FAPSKMHHSRSPFEDSRGYMMMFPRVSSPPAPSPPKEADPEKEDESKDNDSESDYMFMAP
GAGAIPKKPPNPQGGSSSKNWSSYVSLPSPFQGSPLGQSDHSEYVPMLPGKFPGKGLDKE
ASSSGGPKDAVSKPSAEGSFSKRGDGVSLTKPSDDGPPKNKAKRPNSLSFITKGNKIKPK
SQKPTPEQRGAGSSHDYVNIDFTKRESNVPAPFIHGLPGSWGIIAGPRRSAFSNYVNVEF
GLPFPNQAHRLSNLLRAIPGANPLYLEGARWPLVPLPPNSAGGSANEEEGDYIEVIFNPA
MTPAVPFGDRAIRYDPETGRIYVVDPFSECCMDISLSPGRCFEPPPVARLLQEEQQQPER
RRPQSRSQSFFGSARAAVSAFSTDSLERDLSSPLAAAAAASAAAPALALSQAFAAASALV
VAPGVGAAARGLEAAAGFNSASARWFQPVAGAAAAAEAVRGAPNVAGGSNLRAPNPFADL
AGGENGAAAAAPRPPPRRPVPRPPGREDPDEDDDDDDDIYVRMDFARPDNKKFDSPRRE
Download sequence
Identical sequences M3XXY1
ENSMPUP00000003932 ENSMPUP00000003932 XP_004769093.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]