SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003940 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003940
Domain Number 1 Region: 124-221
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-25
Family SH2 domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003940   Gene: ENSMPUG00000003972   Transcript: ENSMPUT00000004011
Sequence length 424
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897177.1:395567:403566:1 gene:ENSMPUG00000003972 transcript:ENSMPUT00000004011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPLTQLCPQGTSRAPPPTFSTFQPRRGCREVALLQAPEAEEDQPNPRVTAVHTAVSGT
PAGTASSSAPIPHPAPPQPPGAASSPEDAGKAEEGPEEGGQSLQAETRAWFQKTQAHWLL
QHGAAPAWFHGFITRREAERLLEPKPEGCYLVRFSESAVTFVLTYRSRTRCRHFLLAQLQ
DGRHVVLGEDSAHARLQDLLRHYTACPLSPYGETLTEPLLRQTPEPAGLSLSTEGSDPGS
KDPPPQYSPIVKKLQNVTPTQKEGTREQKEPPRPKPPVPAKPQLPPEVYTTPAPRPRPTP
PPKPSNPIYQEPDEAIAFYAMGRGSPGEAPGNVYAEVEAEAPPGAGGAPCVLRHPALRKC
RSRPVPGGQNLGGRSPYSENAVPGQGPPVPHQPLPSWGHTLPHKLSRQRAEDGGQAWLPL
GPPQ
Download sequence
Identical sequences M3XXY9
ENSMPUP00000003940 XP_004778530.1.14098 ENSMPUP00000003940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]