SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003953 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003953
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily PDZ domain-like 2.29e-18
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003953   Gene: ENSMPUG00000003985   Transcript: ENSMPUT00000004024
Sequence length 252
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:508186:516729:1 gene:ENSMPUG00000003985 transcript:ENSMPUT00000004024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVINSGLPLPLGQILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTED
ALGLTITDNGAGYAFIKRIKEGSIINRVQAVCVGDSIEAINDHSIVGCRHYEVAKMLREL
PKSQPFTLRLVQPKRAFDMISQRSRGSKCPTEAKMASGRETLRLRSGGAATVEEMPSEFE
EEASRRVDDLLESYMGIRDPELAATMVDTSKKTRSVQEFAHRLDSVLGEFAFPDEFVVEV
WAAIGEAREACG
Download sequence
Identical sequences M3XY02
ENSMPUP00000003953 ENSMPUP00000003953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]