SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003964 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003964
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 1.13e-78
Family Sec7 domain 0.00000000469
Further Details:      
 
Domain Number 2 Region: 260-375
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-34
Family Pleckstrin-homology domain (PH domain) 0.000000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003964   Gene: ENSMPUG00000003997   Transcript: ENSMPUT00000004036
Sequence length 400
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:2164977:2173018:-1 gene:ENSMPUG00000003997 transcript:ENSMPUT00000004036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLEGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKEEWIKSIQAAVSVDPFYEMLAARKKRISIKKKQEQP
Download sequence
Identical sequences M3XY13
ENSMPUP00000003964 ENSMPUP00000003964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]