SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003972 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003972
Domain Number 1 Region: 484-562
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.27e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000106
Further Details:      
 
Domain Number 2 Region: 276-315
Classification Level Classification E-value
Superfamily WW domain 0.00000556
Family WW domain 0.0054
Further Details:      
 
Domain Number 3 Region: 598-667
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000496
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003972   Gene: ENSMPUG00000004005   Transcript: ENSMPUT00000004044
Sequence length 754
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:3523277:3552627:1 gene:ENSMPUG00000004005 transcript:ENSMPUT00000004044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRACPLQALPREQSPPPPLQTSSDAEVMDVGSGGDGQAEPPAEDPLNFYGASLLSKGS
FSKARLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTG
VERDTRAECGLALSPVSGDVHACPFGGSVGNGVGIGGESADKKDEENELDQEKRVEYAVL
DELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFSYEDDFDNDVDALLEEGLCAPK
KRRMEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGIPVY
LHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKDNEEREQNSELAPSGEVSPV
KPLSRSAELEFPLEEPDSIGADSGALDEKDTLGAEAAPGALGQVKAKVEVCKDESVDLEE
FRNYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPT
KKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTAS
SKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLS
PYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQK
ILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEM
KRLAEEREETRKKPKMSIVASAQPGGEPLCTVDV
Download sequence
Identical sequences M3XY21
ENSMPUP00000003972 ENSMPUP00000003972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]