SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004000 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004000
Domain Number 1 Region: 7-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.53e-100
Family Calpain large subunit, catalytic domain (domain II) 0.000000355
Further Details:      
 
Domain Number 2 Region: 356-497
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.57e-33
Family Calpain large subunit, middle domain (domain III) 0.00034
Further Details:      
 
Domain Number 3 Region: 519-631
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.26e-16
Family PLC-like (P variant) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004000   Gene: ENSMPUG00000004033   Transcript: ENSMPUT00000004072
Sequence length 641
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897040.1:4302716:4325858:-1 gene:ENSMPUG00000004033 transcript:ENSMPUT00000004072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPLKVFKNQKYQELKQECIKDGRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDD
PRLIVGNISNHQLIQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPRKLDKYAGI
FRFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGL
TTTDIIVDFTGTLAETVDMQKGRYTELVEEKYKLFGELYKTFTKGGLICCTIESPNQEEQ
EVETDWGLLKGHTYTMTDIRKIRLGERLLEVFSTEKLYMVRLRNPLGRQEWSGPWSEISE
EWQQLTVADRKNLGLVMSDDGEFWMSLEDFCRNFHELNVCRNVNNPLFGRKELESVVGCW
TVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYI
IGFELFKVEVNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTS
EFLLRIFSEVPVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEGLEKKYANETVNPY
LIIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQVTLDA
DPSDCRDLKSLYLRKKGGPTAKVKQGHISFKVISSDDLTEL
Download sequence
Identical sequences M3XY49
ENSMPUP00000004000 XP_004769135.1.14098 ENSMPUP00000004000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]