SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004018 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004018
Domain Number 1 Region: 240-374
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.32e-36
Family Synaptotagmin-like (S variant) 0.0000127
Further Details:      
 
Domain Number 2 Region: 74-207
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.27e-23
Family Synaptotagmin-like (S variant) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004018   Gene: ENSMPUG00000004052   Transcript: ENSMPUT00000004091
Sequence length 383
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:5079713:5083145:-1 gene:ENSMPUG00000004052 transcript:ENSMPUT00000004091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTAAVSRGRPRRVTMREHMAIDVSPGPIRPIRLISDYFPHFYPFAEHTLRTPEPQPAV
TPTPQPQPDPEPEGDSDDSTALGTLEFTLLFDADNSALHCTAHRAKGLKPPASGSVDTYV
KANLLPGASKASQLRTRTVRGTRGPVWEETLTYHGFTCQDAGRKTLRLCVCEDPRLRRRR
RAPPLGELRVPLRKLVPNRARSFDVCLEKRKLTKRPKSLDTARGMSLYEEEEVEAAGEER
GRILLSLCYSSRRGGLLVGVLRCAHLAPMDANGYSDPFVRLFLHPNVGKRSKYKTSVRKK
TLNPEFNEEFFYAGPREELAQKTLLVSVWDYDLGTADDFIGGVQLSSQAGGERQWHWCEC
LGRSDHRLELWHPLDGASLQLSD
Download sequence
Identical sequences M3XY67
XP_004759598.1.14098 XP_004759599.1.14098 ENSMPUP00000004018 ENSMPUP00000004018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]