SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004028 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004028
Domain Number 1 Region: 364-474
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-28
Family PDZ domain 0.0062
Further Details:      
 
Domain Number 2 Region: 9-104
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-22
Family PDZ domain 0.00039
Further Details:      
 
Domain Number 3 Region: 183-274
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-18
Family PDZ domain 0.044
Further Details:      
 
Domain Number 4 Region: 475-556
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000163
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004028   Gene: ENSMPUG00000004062   Transcript: ENSMPUT00000004101
Sequence length 708
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:595760:621055:1 gene:ENSMPUG00000004062 transcript:ENSMPUT00000004101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDMEELTIWEQHTATLCKDPQRGFGIAISGGRDQPSGSVIVSDVLPGGPAEGRLRLGDH
IVMVNGVSMESVTSTFAIQILKTCTKLANITVKRPRKIQLPATKTSPSGRGHRDSDEVDH
GRGYEGDTSSGSGRSWDERSRRPRAGRRSRAGSHGRRSPGASSEANGLALVSGFKRLPRQ
DVHMRPLKSVLVRRRESEEFGVTLGSQIFIKHITDSGLAARNHGLQEGDLILQINGVSSK
NLSLSDTRRLIEKSEGKLTLLVLRDQGQFLVNIPPAVSDSNSDSSLLDDISDLGSELSQA
PPSHVPPPPRHVRRSLDASQTDSPEESPPPHRENSVDSRTVSEPGELIGEDSPRPSSYDI
YRVSSSQSVEDRGYSPDSRVVRFPKGTTIGLRLAGGNDVGIFVSGVQEGSPADGQGIQEG
DQILQVNDVPFRNLTREEAVQFLLGLPPGEEVTLVTQRKQDIFRKMVQSRVGDSFYIRTH
FELEASPPSGLGFTRGDVFHVLDTLYPGPGQSRTRGGHWLAVRMGRDLREQERGIIPNQS
RAEQLASLEEAQRAVGAGPGASGGSSARAEFWRLRGLRRGAKKTTHRSREDLSALTRQGH
YPPYERVVLREASFKRPVVILGPVADIAMQKLTAEMPDQFEIADSVLRADRPSKIIKLDT
VRMIAEKVSGDSPSAPRGGAVMWGLGRDRRALGHLRPAGPAVRGRAPP
Download sequence
Identical sequences M3XY77
ENSMPUP00000004028 ENSMPUP00000004028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]