SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004042 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004042
Domain Number 1 Region: 65-252
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.22e-73
Family T-box 0.000000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004042   Gene: ENSMPUG00000004076   Transcript: ENSMPUT00000004115
Sequence length 385
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:5088406:5092308:-1 gene:ENSMPUG00000004076 transcript:ENSMPUT00000004115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAFLSAGLGVLASSEPYTLPMTSSGWEPRLDSPFPPGPSTGSAGTQVVAEPSKQGPKNP
RVSSVTVQLEMKALWEEFNQLGTEMIVTKAGRRMFPTFQVKILGMDTLADYALLMDFVPL
DDKRYRYAFHSSAWLVAGKADPVTPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDD
NGHIILNSMHRYQPRFHVVFVDPRKDSERYAQENFKSFIFTETQFTAVTAYQNHRITQLK
IASNPFAKGFRETDSDSWTVSPRALLSIPARSHSSLSPCLLQGPAEQEKDPNKAPASNSR
TSAQVHHQLLAPTDTLLAPATYQPLNYQGLYPGASSPLRIPRARPTPYPLPNIQAGRDQE
GLPLPARLGLLSPTAMCLGPVQDPQ
Download sequence
Identical sequences M3XY91
ENSMPUP00000004042 ENSMPUP00000004042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]