SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004044 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004044
Domain Number 1 Region: 22-193
Classification Level Classification E-value
Superfamily RUN domain-like 9.94e-34
Family RUN domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004044   Gene: ENSMPUG00000004078   Transcript: ENSMPUT00000004117
Sequence length 1019
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:14896491:14949204:-1 gene:ENSMPUG00000004078 transcript:ENSMPUT00000004117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPEGAGMELGGCEERLPEESRREHWQLLGNLKTTVEGLVSANSPNVWSKYGGLERLCRD
MQSILYHGLIHDQQVCCRQTDYWQFVKDIRWLSPHSALHVEKFISLHENGESGADGESGD
SDSRRAVAELWLQHSLQRHCLSAQLRPLLGDRQYIRKFYTDTAFLLSNAHVTAMLQCLEA
VEQNNPRLLAQLDASMFARKHESPLLVTKSQSLTALPGSTCTTSTSYAQHPYFGSFSSLH
QSAPNHSSERRTTSFSLSGPPRKPQESKEHVSPARDQTFQAPLLAVSSLAGDPPSTPNEM
SSSTLTSPLEASQVSNQNESPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLF
SSSSSQKPDSAASSLGEQEGGGQSQLSSILRRSSFSEGQTLTATSGTKKSHTRSHSDTNI
ASRGAPGGPRNITIIVEDPIAESCNDKSKLRGPLPYSGPSSEVSTPSSLYMEYEGGQYLC
SGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLE
EEEEEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQETEHGTGFRVTSSSSQFSSRDST
QFSDSGSADEVDEFEIQDGSEGSNLTHMSKNGLSVSMASMFSDADIRRSTASNSKSFTSS
QSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPD
DGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYI
KRLRYCEYLGKYFCQCCHENAQMVIPSRVLRKWDFSKYYVSNFSKDLLIKIWNDPLFNVQ
DINSALYRKVKLLNQVRLLRIQLYHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLN
DLTATRKGELGPRLAELTKAGAAHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCE
ECKACYHKACFKSGSCPRCERLQARRELLAKQSLESYMSDYEEEPTEALALEATVLEAT
Download sequence
Identical sequences M3XY93
ENSMPUP00000004044 XP_004745431.2.14098 ENSMPUP00000004044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]