SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004069 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004069
Domain Number 1 Region: 153-224
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000108
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004069
Domain Number - Region: 7-41
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000167
Family Intermediate filament protein, coiled coil region 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004069   Gene: ENSMPUG00000004103   Transcript: ENSMPUT00000004142
Sequence length 1731
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897177.1:498786:507238:1 gene:ENSMPUG00000004103 transcript:ENSMPUT00000004142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGCLGEESFQMWELNRRLEAYLARVKALEEQNELLGAELGGLRAQTGDASWRARADDEL
AALRALVDQRWREKHAAEVARDNLAEEVAGVAGQCQAWRGAVRGYQERVARMETSLGQAR
ERLGRAVQGAREGRLELQQLQAERGGLRERRAALEQRLEGRWQERLRATEKFQSAVEALE
QEKLGLQGQIAQVLEGRQQLAQLKMSLSLEVATYRTLLEAENSRLQTPGGVSKASLCFQD
PKLELHFPGTPEGRHLGPLLSALSPTSLSLPLPDTLETPVPGFLKSREFLQARTPTLAST
PIPPTLPAPCAVIDAEIGAQDAPLSLLQPQIGREQAPEAMQALAIPSSILPGPEEPGGEQ
QEAGTGQSSEDHTSLAPSLSPDPCSLEAKGREPRGSRMVSRFQDEGEGQIWGLAEKETAI
EVKMVNSLQQETRQEDGALNMKEIQDSQGPLEEETLKSVEEEIQESLISLEKQSHETLRS
LEANPESLRSLEEERLDASKDLEKENQELLTSLEEKDVEVLRPLEKETQGLLKPVGKEDP
QTLQSVEKENGELMGSLEGNGETFLYPEKENHVLERCLEENFESMRDSEKETQEPLRSLE
DENLENLRLLEKENQESLNSPEDEKHKTLRPPEKENQEPVRCLEKDDQGTLRPLEKENQE
SLRSLEEEDQESVRPLEEEYQEPERSVGDENQETLGSLEKEKQRSLGSLEEEDQKIVIPV
EENQEAVRSLEEDQETLNPLEEEYQEPVKSVEDENQETLGSLEKETQRSLRSLEEDRETV
RPLENEHQEPMVSLVEEDQAILRLLEKENHESMKSLEDENQETLGSLEKENQRSLGSLEE
EGQETVSPLEKENQEPVECLEEEGQETLRSLEKENQDPVGCLVEEDQATLRSLEKVKPEP
PMSLGKDQEIFRSLENENQQLLWFLKEESSKARRSSESENLEPPKSAGSDWGILKSLETQ
EPLWSPEEMSQKTTKPLDKEIQEPLESVEDSQEMPRPLEKEARESLGRVGEWNLENQGPP
EELGQESQRSPTEEETPAQTGDLEPPRSLKEAGRQSPARAHQQGREDTLGCGEQDQDSPP
GRAAVGQEAEAKPIIVRESGGFAGKEEPEGCGQLWLAAAGEAWSAGEGHPGSPEPREQSA
PVEGASGEGGIEGFRDPEGPPEQVRAPGIQPAQEVSEARELVLEGGQESPGGDQASPEVT
LGLGTAVGESAAGSWQGPEREVGGPEDPGCPAREEGTTPPTGKEGLEGERRQGSEGSRED
PEEADALDPELSTLSRRSMDPLEPSRGWEEAELEAPWGAESGLPAETEGPSPGGSSRGAP
WPGPLALEEAGEAELVLGPTEPRAPTPVPGDAPGLQLLAEGSREAGWGLDGRAEALAGLE
GEQEGLGSEGSAEDLREGENREDSEADELGETLPDPTPLGLYLQSQASPRWDPVGEPRPS
PQGEARKEGWSPPVPTSEGCGAQRGGGEDQDEEEECGQDSDLSEEFEDLEAEASRLPGVP
REAVEPLGRAPEPAAWAGEGESDGFADEEESGEEGEEDKEEEDGGQPGAGPWGPGSSVRP
LPALNGPPRGTFPGFEATDGTVAWVDGPRDAAAGVRRTALETESQDSSEPSGSDGESGPV
SLEREDQVPDPLGTLGGVGDSLGVPGQGPSLKEELERVSGGAVNGLQQSDRGEQGTLGGP
AGDPGSPLEEEDNEGGALKSPWAGPPLHLGVGQFLKFTPRDDVGSWSSGED
Download sequence
Identical sequences M3XYB8
ENSMPUP00000004069 ENSMPUP00000004069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]