SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004082 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004082
Domain Number 1 Region: 9-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.44e-258
Family Motor proteins 0.0000000000139
Further Details:      
 
Domain Number 2 Region: 1044-1092
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000381
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004082   Gene: ENSMPUG00000004116   Transcript: ENSMPUT00000004155
Sequence length 1103
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897139.1:154044:445362:1 gene:ENSMPUG00000004116 transcript:ENSMPUT00000004155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKGAYRYHWQSHNVKHSGVDDMVLLSKITENAIVENLKKRYMDDYIFTYIGSVLISVN
PFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMFRNMIIDRENQCVIISGESGAGKTV
AAKYIMSYISRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSP
GGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSL
SGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGVLHLGNISFKEVGNYAAVE
SEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALH
ARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQT
LLQKLQMQIGNHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELP
FIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRVFQKFLQRYAILTKATWPSWRGDEKQGVLHLLH
SVNMDSDQFQLGKSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMRE
EASDLLLNKKERRRNSINRNFIGDYIGMDDHPELQQFVGKREKIDFADTVTKYDRRFKGV
KRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRRIEMERVLSVSLSTMQDDIFILHEQE
YDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFH
QGFGDLAILKPSNKVLQVSIGPGLPKNSRPTRRNTAQNRSYSGGMHNANYPMRAAPPPPG
YHQNGVLKNQFLPHPHAAGNQRLNQKSLYTSMARPPLPRQQSTGSDRVSQTPESLDFLKV
PDQGAAGVRRQTSSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDI
IKEDPSGWWTGPLGYVIRVCMRH
Download sequence
Identical sequences M3XYD1
ENSMPUP00000004082 ENSMPUP00000004082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]