SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004093 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004093
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily PH domain-like 4e-57
Family Ran-binding domain 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004093   Gene: ENSMPUG00000004127   Transcript: ENSMPUT00000004166
Sequence length 209
Comment pep:known scaffold:MusPutFur1.0:GL896906.1:3560109:3567260:1 gene:ENSMPUG00000004127 transcript:ENSMPUT00000004166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAKDTHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNNDAEKV
TEKLEALSVKEESKESEDTESKAAAEEEQ
Download sequence
Identical sequences M3XYE2
XP_004742686.1.14098 ENSMPUP00000004093 ENSMPUP00000004093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]