SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004101 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004101
Domain Number 1 Region: 171-430
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-68
Family Nuclear receptor ligand-binding domain 0.00000841
Further Details:      
 
Domain Number 2 Region: 103-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004101   Gene: ENSMPUG00000004135   Transcript: ENSMPUT00000004174
Sequence length 437
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897049.1:1698521:1710285:1 gene:ENSMPUG00000004135 transcript:ENSMPUT00000004174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLRLFPSASLPPSLPPSRSPPSPLPLPPPSSPHSPLSTSPHLPFSLPAASPRALLGSPR
SPQSRAQRGLPPGQRRRRGRPRPGLAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQF
TCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRM
PPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICE
LAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAG
LHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSAARADACGLSD
AAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKT
PIETLIRDMLLSGSSFN
Download sequence
Identical sequences M3XYF0
ENSMPUP00000004101 ENSMPUP00000004101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]