SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004108 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004108
Domain Number 1 Region: 373-475,506-751
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.98e-112
Family Oxysterol-binding protein 0.0000407
Further Details:      
 
Domain Number 2 Region: 70-181
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004108   Gene: ENSMPUG00000004142   Transcript: ENSMPUT00000004181
Sequence length 756
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:15319296:15416799:1 gene:ENSMPUG00000004142 transcript:ENSMPUT00000004181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGVKMQGGEPLATMKVSESEGKLEGLATAVTPNKNSSNSSCGGGISSSSSSRGGSAKG
WQYSDHMENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGA
VISPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKNNPPLKSR
SFSLASSGNSPISQRRPSQNAISFFNVGHSKLQSVNKRANLPPDHLVEVREMMSHAEGQQ
RDLIRRIECLPASGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHASHQKGSLSSGT
TIEWLEPKIPLSNHYKNGADQPFATEQSKPVAVPEEQCVEESGPLAREPEEISADDEVED
TCDNKEDDLGAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDL
FIAITNGATAEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWRVPKSEVAST
VVSSSSTQAITNHTPLSEETLSQVGSDYYTVRFVAEQVSHHPPVSGFYAECAERKMCVNA
HVWTKSKFLGMSIGVTMVGEGVLSLLEHGEEYTFSLPCAYARSILTVPWVELGGKVSVNC
AKTGYSASITFHTKPFYGGKLHRVTGEVKHNITNTVVCRVQGEWNSVLEFTYSNGETKYV
DLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKRTLEERQRTEERHR
TETGTPWKTKYFIKEGDGWVYHKPLWKLIPTAQPAE
Download sequence
Identical sequences M3XYF7
ENSMPUP00000004108 ENSMPUP00000004108 XP_004745454.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]