SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004111 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004111
Domain Number 1 Region: 213-357
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000281
Further Details:      
 
Domain Number 2 Region: 382-493
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-19
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 3 Region: 486-569
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000302
Family PDZ domain 0.0000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004111   Gene: ENSMPUG00000004145   Transcript: ENSMPUT00000004184
Sequence length 577
Comment pep:known scaffold:MusPutFur1.0:GL897062.1:622474:630225:-1 gene:ENSMPUG00000004145 transcript:ENSMPUT00000004184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLTALQSPAGPPAMDLEEPRDTLSSSQDLPPRCQWDPVPRRSGSLGQMELDGPSIEDL
VPQFEALPGDLVGSSPDGPPCPLHVATGHGLASGDIADGHGLLSAEAGRDDLLSLLHCQE
CPPSQSCPKEPPDPAPRPLQPPEDPDGDTSAPEWAEGASAEQGGSRSSSSSPEPWLETVP
LVAPEEPRASTQSPKTPVPYPALQEVPGPCDHEDLLDGVIFGAKYLGSTQLVSERNPPPS
TRMAQAREAMDRVKAPDGETQPMTEVDLFVSTKRVKVLTADSQEAMMDHALQTISYIADI
GSVLVLMARRRLARRPASQAPSHKLYKMLCHVFHSEDAQLIAQAIGQAFSVAYSQFLWES
GLDPSQVGAQQSQAAGPGHLHNGDLDHFSNSENCREVCIEKRRGEGLGVALVESGWGSLL
PTAVIANLLHGGPAERSGALSIGDRLTAINGTSLVGLPLAACQAAVREVKSQTSVTLSII
HCPPVTTAIIRRPHAREQLGFCVEDGIICSLLRGGIAERGGVRVGHRIIEINGHSVVATP
HARIIELLTEAHTEVHIKTMPAATYRLLTGQEQPVYL
Download sequence
Identical sequences M3XYG0
ENSMPUP00000004111 XP_004771462.1.14098 ENSMPUP00000004111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]