SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004117 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004117
Domain Number 1 Region: 59-186
Classification Level Classification E-value
Superfamily PX domain 2.75e-27
Family PX domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004117
Domain Number - Region: 229-345
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00188
Family Arfaptin, Rac-binding fragment 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004117   Gene: ENSMPUG00000004151   Transcript: ENSMPUT00000004190
Sequence length 450
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:15437251:15505541:1 gene:ENSMPUG00000004151 transcript:ENSMPUT00000004190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQAPRDPERQLQPAPLEPLGHLDAGLQSAVGEEAEVARDESPGEGTMTENNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRNYLLVY
YPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRVASHPILCRDKIFYLF
LTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTELKHYSDELQSVISHLLRV
RARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELATGTVRMFSLKGMTT
KLFGQETPEQREARVKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNHDLKE
ALISYAVMQISMCKKGIQVWTNAKECFSKM
Download sequence
Identical sequences M3XYG6
XP_004745455.1.14098 ENSMPUP00000004117 ENSMPUP00000004117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]