SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004137 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004137
Domain Number 1 Region: 214-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.61e-111
Family Motor proteins 0.0000000413
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000021
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004137   Gene: ENSMPUG00000004171   Transcript: ENSMPUT00000004210
Sequence length 1365
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:157372:226411:-1 gene:ENSMPUG00000004171 transcript:ENSMPUT00000004210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSWLYECLCEAELAQYYPHFTALGLQKIDELAKVTMKDYSKLGVRDMNDRKRLFQLIKI
IKIMQEEDKAVNSPEHPLQTDSLCSKPRESRSGPRRQLHFDSPADNKDRTTSNSGFERHS
LSDFSANEQKSSYLKVLEHMLPDDSHYHTKTRILSAAAAGSYVQTETNTSLFSSNHYSPL
LGDCDGPIIQRVSHVSGYNYGIPHSCIRQNTSEKENPWTEMEKIRVCVRKRPLGMREVRR
GEINIITVENKETLLVHEKKEAVDLTQYILQHVFYFDEVFGEACTNRDVYMKTTHPLIQH
IFNGGNATCFAYGQTGAGKTYTMIGTHQNPGLYALAAKDIFRQLEVSQPRRPLFVWISFY
EIYCGQLYDLLNRRKRLFAREDSKHVIQIVGLQELQVDSVDLLLEVILKGSKERSTGATG
VNADSSRSHAIIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLL
ALKECIRALDQEHTHTPFRQSKLTQVLRDSFIGDAKTCMIANISPSHVATEHTLNTLRYA
DRVKELKKGVKCCTSATSRNQTSGNSSPKRIQSSPVALPGDKCSPKKVKLGLQQSFMAAP
GSTKGKAYPLASHPPNIPFAPVPKVPGKTGSSRGSPPQEWVVQTSPVKGATQSRHSAKKR
AEESAPLCCEKNQMGNRTARRWGSKAAGPGEAPARGKLPSKCKTVQPVQPVQRQLVSRAE
LSSGSLHHLAKSGQGSKGSTPARPASEVWTDIPPHQKEREEHLRFYHQQFQQPPLLQQKF
NYQPLERFLCQYRPLEGQFQNETPLPFCSYSESQDGAHAEDLDDSDFSEDSFSHVSSQRT
TKQRNTLENSEGSFFLHQREEGAAEVAERQQSLLFNPRTDGDEKGPTGNWMYSRNPTNYR
GAALSHGHGSSKVTLDCSREESSSLELSPRDNPTEKPYCSQVDFVCGRKGGGDPPSELRQ
NAFRSEAPGQAEGSSLPPEEDSFIFSLSHEAFPGSPDQRETVSTPLREVGQDSPTLVTET
MKNSYPYQEGNCRGESGTCSEYASGLMAPLTVSLLENTDDEGPLPLERLAQDGLAHSPVA
AGGPPVGNTVSSGDQKALLPVSSAAGHLWLSSSPPDNKPNGDLPALSPSPIRQHPPETLP
ISETDPGEVCQSREPVLSSQEHSSSKQCDADAEAAELSSSQGFPEKPFPHIHIGGPHPAP
LLTARTESSVMADQPWAQERKSPKGLGWQELSLLRDPIIKLPCYNSNIMWLKYRPIPRCL
ARPGSPLAPGSSPETAGTLPQLTLGPAQQVVIRAHQEQLDKMAELVFKEETLMSQLALHD
FEDFVTQLDEILALKSQCIQGLRSQLQLYRACHRPATAPERTVVA
Download sequence
Identical sequences M3XYI6
ENSMPUP00000004137 XP_004747464.1.14098 XP_004747465.1.14098 XP_004747466.1.14098 XP_004747467.1.14098 ENSMPUP00000004137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]