SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004156 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004156
Domain Number 1 Region: 1966-2071
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-29
Family PDZ domain 0.0000631
Further Details:      
 
Domain Number 2 Region: 1602-1717
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-26
Family PDZ domain 0.015
Further Details:      
 
Domain Number 3 Region: 350-466
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-26
Family PDZ domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1855-1954
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-25
Family PDZ domain 0.0043
Further Details:      
 
Domain Number 5 Region: 1145-1245
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-25
Family PDZ domain 0.0000156
Further Details:      
 
Domain Number 6 Region: 234-339
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-25
Family PDZ domain 0.011
Further Details:      
 
Domain Number 7 Region: 1724-1809
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-24
Family PDZ domain 0.0046
Further Details:      
 
Domain Number 8 Region: 130-230
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-23
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 9 Region: 691-787
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-23
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 10 Region: 1340-1437
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-22
Family PDZ domain 0.052
Further Details:      
 
Domain Number 11 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 1.84e-19
Family L27 domain 0.00069
Further Details:      
 
Domain Number 12 Region: 1469-1568
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-19
Family PDZ domain 0.0061
Further Details:      
 
Domain Number 13 Region: 549-638
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-18
Family PDZ domain 0.037
Further Details:      
 
Domain Number 14 Region: 992-1094
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004156   Gene: ENSMPUG00000004191   Transcript: ENSMPUT00000004231
Sequence length 2072
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897013.1:5086705:5213009:1 gene:ENSMPUG00000004191 transcript:ENSMPUT00000004231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLETIDKNRALQAAERLQAKLRERGDGANEDKLNLLKSVLQSPLFSQILNLQASVQQLKD
QVNTTASAISNVEYAHIPNLSPAVIPPLQNELFLSSSNNGNLEAFIGSGTIHVNGKPACD
EFDQLIKNMAQGRHVEVFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDG
RLKETDQILAINGQALDQTITHQQAISILQKAKDNVQLVIARGSLPQLISPIVSRSPSAA
STISAHSNPVHWQHVETIELVNDGSGLGFGIVGGKATGVIVKTILPGGVADQHGRLCSGD
HILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEEPAAPTSLGITLSSSPSSTPE
MRVDASTQKSEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDG
RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGPTVHLTLMRRGAKQEAELASREDVTKDA
VLSPVNAGGSKENYEKDEESSSLSRNTSILPVEEEGYPLLSADIEDTEDAQQQEAALLTK
WQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELL
EVNGITLLGESHQDVVTILKELPIEVTMVCCRRTVPPTSQTGLDSLDLCDIELTEKPHVD
LGEFTGSSETEDPVLAMTDDVGQNAEEVQGPLAMWEVDVQHIELEKGNKGLGFSILDYQD
PIDPASTVIVIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVQALKGAPAGTV
RIGVAKPLPLSPEEGYVSSKEDSFLHPPNSCEEEGLADRAVFRADLALVDTNEADLADES
TFESQYSPDNDSIYSTQASLLSLHGSAGSDGLNYGTSLPSSPPKDITENSSDPVFDLHMS
LEELYTQNLLQRQDESLSSADLSMGPASGFTANDYTPANATEQQYKCENKRTWADSHPPN
EMISSAERPSPVLPDSAGKGSEFLIQQSSLTSTAECVMLQNLSEESFERTITIAKGNSSL
GMTVSANKDGLGMIVRSIIHGGSISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHS
LIGPDIKITYVPAERLEEFKISLGPQSGGIMALDIFSSYSGRDIPELPEREEGEGEESEL
QNAAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGK
NGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLSSLPHNL
YPKYNFSSTNPFADSLQFNADKAPSQSESEPEKAPLCNVPPPLSSAFAEMSSDNTQSSAG
KLSEDVDKEDEFGYSWKNIRERYGTLAGELHMIELEKGRSGLGLSLAGNKDRSRMSVFVV
GIDPNGAAGKDGRLQTADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVSQ
MAVCPGNTVEPLPSTSEQSQNKEPEPSGATSDAAVDLCSLKNVQHLELPKDQGGLGIAIS
EEDTLSGVIIKSLTEHGVAAKDGRLKIGDKILAVDDEVVVGYPVEKFISLLKTAKTTVKL
SICAENRDPQTVASAAGTASGEQKSSSLSPMAPSSGSPEPESIPSTSRSSTPAIFASDPA
TCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQIL
EVNGIDLRKATHDEAINVLRQTPQRVRLTLYREEAPYKEEDVYDTLTVELQKKPGKGLGL
SIVGKRNDTGVFVSDIVKGGIADADGRLVQGDQILTVNGEDVRNATQEAVAALLKCSLGT
VTLEVGRIKAGPFHSERRPSQSSQMSEGSLSSFTFPLSGSSTSESLESSLKKNALASEIQ
GLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICG
TSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSGLSFTGLTSSSIFQE
DLGPPQCKSITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQII
AVNGQSLEGVTHEEAVAILKRTKGTVTLMVLS
Download sequence
Identical sequences M3XYK5
XP_012918552.1.14098 ENSMPUP00000004156 ENSMPUP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]