SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004179 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004179
Domain Number 1 Region: 885-1009
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-27
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily BRCT domain 2.33e-18
Family BRCT domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004179   Gene: ENSMPUG00000004213   Transcript: ENSMPUT00000004254
Sequence length 1145
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897049.1:2609382:2683129:1 gene:ENSMPUG00000004213 transcript:ENSMPUT00000004254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGAPKHIIQMTGFKMEEKEALGKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWVLTKDYIIHSAKSGRWLDETTYEWGYKIEKDSHYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRADKRSDSLVRVPEDRVPEDRNEDGGLPISGPEEPELRFSLLSAPSE
KSAQLPPSPWPLIALGGKCSMGHTWRNAPSRFCLHGLRPRSKLTQPATSSRVLEAGKANV
ILPKSSPSGITHVIASNARIKAEQEKDHFKAPFYPIQYLGDFLLEKEIQNDEDSQIHSVW
NKHSNQEKNKDFWKDKGFLKMKGALKETMCRTQKEMKNHDEDVNVSSLLTEHHKKEKFRD
SSRDLKLVKMRDTLRRHTCKSQKEIKKRDEDIQRSYTLRKKRKKENERDSRKDIEHNKLK
STSRKHIYRDQKEMKSSFFADRAKESKAKDVRTDVDIAEIKNELKKHIYRAQAIRYSCIK
IDKQPVYNIEVKNAEFPRGILNLIESLIEGQFFKEAIEELSSLQAHYIPPVCLLHALLEN
ILQDNIDTFSGRYFHILSALLHLHPPWKSPAMSRYYLELFQCPTCMKGAWSLIEVLIRSC
LYNESFCHQISKNIIGTKVLYLTLLKFFFNLVESEVRHLIQKLYDWSDSQSLKITGKAIL
LEIFWSGNEASGLLTKPVNMLLEWTIYSHKEKCKSNDVFKHELAYLLTGILGAAIDYWIF
LGLKRGKNVMRHMSDDLGSYVSLSCDDFSSQELEIFICSFSSSWLQMFVAEAVFKKLCLQ
SSISVSSEPLSLQKMVYSYLPALGKTGVHGTGKTQIPKKIGQRPCLESQRALLMLNGVKQ
KQVEGLPELPELNLAKCSSLKRLKKKSEGELSCSKENCPSLVTKMNFHKTNLKGETALHR
ACINNQVEKLILLLSLPGIDINVKDNAGWTPLHEACNYGNTVCVQEILQRCPEVDLLTQV
DGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNSKGELPLDYVVSSQIKEELFAITKIE
DTVENFHAQAEKHFYHQQLEFGSFLLSRMLLNFCSIFDLSSEFLLAFKGLTHLNELLVAC
KNYKETTSAHTDWLLDLYARNIKTLQMLPNILKELPDNLKVCPGVHTEALLVTLEMMCRS
VTEFS
Download sequence
Identical sequences M3XYM8
ENSMPUP00000004179 ENSMPUP00000004179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]