SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004182 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004182
Domain Number 1 Region: 931-1060,1092-1306
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-67
Family p120GAP domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-37
Family Calponin-homology domain, CH-domain 0.0000255
Further Details:      
 
Domain Number 3 Region: 1514-1609
Classification Level Classification E-value
Superfamily RGC domain-like 3.53e-29
Family RGC domain 0.0000132
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004182
Domain Number - Region: 648-677
Classification Level Classification E-value
Superfamily WW domain 0.000222
Family WW domain 0.0024
Further Details:      
 
Domain Number - Region: 759-826
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000443
Family Motor proteins 0.039
Further Details:      
 
Domain Number - Region: 702-765
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0234
Family Motor proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004182   Gene: ENSMPUG00000004216   Transcript: ENSMPUT00000004257
Sequence length 1610
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897177.1:580841:611794:1 gene:ENSMPUG00000004216 transcript:ENSMPUT00000004257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEESLRNGVLLAKLGHCFAPAVV
PLKKIYDAEQLRYQATGLHFRHTDNINFWLSAVAHIGLPSTFLPETTDIYDKKNMPRAIY
CIHALSLFLFRLGLAPQIHDLYGKVKFSAEELSNMAAELAKYGLQLPAFSKIGGILASEL
SVDQAAVHAAVLAINEAVERGVVEDTLAALQNPNALLGNLREPLAAIYQELLAQAKAEKA
ASAQTCGGRESWDVYDRFLTQAEIQGNINHVNVHGALEAVDDALERQSPEALLEALLDPA
LALQGLRRNFAGWYLEQLSSDREQKAQELGLLELLEKEEVQAGVAAANMKGDQEQAMLQA
VCRINRAIQRGVAAATVEELMCPEAQLPPVYPSAPAVYQQELRALQQQRGGELGHEELFV
AVEMLSAVVLINQALEAGDVGGFWSSLVNPASGLAEVERENAQRYFDGLAELRRALAGAI
LSWNDLQATVHRVNAQVQEETDQVLAVSLINEALDQGSPEKTLSALLLPSAGLEDISLPV
APQYHLLLVAAKRQKAQATGDPGALLWLEEIRQEVVRANQDTDAAQRMALGVAAINQAIR
EGKAGQTERVLRNPAVALRGVVPNCADSYQRVLEAAMAKKRHPGAPALWVRHGMKDGSAY
YFHLQTLQGTWEPPSGCRLNTSHLTREEIQLAVTKVTTAHDRQQLWKANIGFVIRLQARL
RGFLVRQEFAERAHFLRTWLPAVVKIQAHWRGYRQRKAYLERLQYFRAHSDAVIKIQAWA
RAWAARRRYRRRLGFFQENVESIVKIQAFFRARKARDDYRTLVHAAHPPLRLVCKFAHLL
NQSQEDFLAEAELLKLQEEVVRKIRSNQQLQQDLNLMDIKIGLLVKNRVTLQELVSHCKK
LTKKNKEQLAGLMVLDRQRGLKSLSKEKRQKLEAYQHLLYLLQTQPIYLARLIFHMPQSK
TTKFMESVVFSLYNYASSRREAYLLLQLFKTALQEEIRSKVERPQDMVTGDPTVVRLVVR
FYRNGRGQSALREILGRVIQDVLGDKTLSVHTDPVHLYKSWVNQSEAQTGQRSHLPYDVT
PEQALSHPEVQRRLDISLRSLLALTDRFLAAIMSSVEHIPYGMRYVAKVLKTTLAERFPA
ASEDEVYKVVGNLLYYRFLNPAVVAPDAFDIVAVAAGGALAPSQRHTLGAVAQVLQHAAA
GKAFSGPSRHLRALNDYLEDTHIKFRRFMCRACRVPEPEERFAMDEYSDMVAVAKPVVYI
TVGELLNTHRLLLEHQDWVAPEHCDPLHELLEDLGELPTVSDLIGEGVAAAGNKDPAKLE
VSLTLTNKFEGVETDAGDTGAQSLLLSTKQMLADIMQFQPGDSLQEMLSLPATAEQEAAH
KQLTAERQARESQTPEPLRRHRSLSAHALLPLADKRRRVLRNLRRLESLGLVSARDGYQG
LVDGLAKDIRNQRRHRQRRKAELGKLQVTLQGLDAKTAFYEEQGDYYSQYIRACLDQLAP
RCTSSGKGKKRPALRYTAAQLLEKGVLVEIEDLPTSHFRNVIFDITPGDEAGKFEVNTKF
LGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNVNLLIFLLNKKLLRQ
Download sequence
Identical sequences M3XYN1
ENSMPUP00000004182 ENSMPUP00000004182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]