SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004199 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004199
Domain Number 1 Region: 105-121,162-269
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.29e-33
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Domain Number 2 Region: 319-436
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.82e-31
Family PLC-like (P variant) 0.0000338
Further Details:      
 
Domain Number 3 Region: 15-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-25
Family PLC-like (P variant) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004199   Gene: ENSMPUG00000004233   Transcript: ENSMPUT00000004274
Sequence length 506
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897049.1:2692206:2937194:-1 gene:ENSMPUG00000004233 transcript:ENSMPUT00000004274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFPANTVTNMNQSLSFTGTSDPYVKFKIGGKEVFRSKIIHKNLNPVWEEKACIFVEHLRE
PLYIKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHYLGIILLSVILT
PKEGEHRDVTMLMRKSWKRSSKQKFQTQSLRLSDVHRKSQLWRGIVSITLIEGRDLKAMD
SNGLSDPYVKFRLGHQKYKSKIMPKTLNPQWREQFDFHLYEERGGIIDITAWDKDAGKRD
DFIGRCQVDLSSLSREQTHKLELQLEEGEGHLVLLVTLTASATVSISDLSVHSLEDQKER
EEILRRYSPLRIFHNLKDVGFLQVKVIRAEGLMVADVTGKSDPFCVVELNNDRLLTHTVY
KNLNPEWNKIFTFNIKDIHSVLEVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKN
KQLTGPTKGVIYLEIDVIFNAVKASLRTLIPKEQKYIEEENRLSKQLLLRNFIRMKRCVM
VLVNAAYFVNSCFDWDSPPRSLAAFV
Download sequence
Identical sequences M3XYP8
ENSMPUP00000004199 ENSMPUP00000004199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]