SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004212 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004212
Domain Number 1 Region: 17-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.99e-23
Family PLC-like (P variant) 0.044
Further Details:      
 
Domain Number 2 Region: 161-274
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-21
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 
Domain Number 3 Region: 309-506
Classification Level Classification E-value
Superfamily vWA-like 1.41e-17
Family Integrin A (or I) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004212   Gene: ENSMPUG00000004247   Transcript: ENSMPUT00000004288
Sequence length 548
Comment pep:known scaffold:MusPutFur1.0:GL896910.1:9631873:9677241:1 gene:ENSMPUG00000004247 transcript:ENSMPUT00000004288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYIPSGGAPAAGAAPVGSQYCVCKVELSVSGQNLLDRDVTSKSDPFCVLFTESDGRWIE
YDRTETAINNLNPAFSKKFVLDYHFEEVQKLKFTLFDQDKSSTQLDEHDFLGQFSCSLGT
IVSSKKITRPLLLMNDKPAGKGLITIAAQELSDNQVITLSLAGRRLDKKDLFGKSDPFLE
FYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMDKPIQVMCYDYDNDGGHD
FIGEFQTSVSQMCSARDGVPLEFECINPKKQRKKKNYKNSGIIILRSCKINRDYSFLDYI
LGGCQLMFTVGIDFTASNGNPLDPSSLHYINPMGTNEYLSAIWAVGQIIQDYDSDKMFPA
LGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHV
ARFAAQATQQQTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAM
EFLDGDSRTLRSHTGEEAARDIVQFVPFREFRNAAKETLAKAVLAELPQQVVQYFKHKNL
PPTHSEPA
Download sequence
Identical sequences M3XYR1
ENSMPUP00000004212 ENSMPUP00000004212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]