SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004215 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004215
Domain Number 1 Region: 146-272
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-35
Family Phosphotyrosine-binding domain (PTB) 0.00019
Further Details:      
 
Domain Number 2 Region: 6-110
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000113
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004215   Gene: ENSMPUG00000004250   Transcript: ENSMPUT00000004291
Sequence length 407
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896992.1:5778020:5784091:1 gene:ENSMPUG00000004250 transcript:ENSMPUT00000004291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVAVKQGFLYLLQQQTFGKKWRRFGAVLYGESDCALARLELQEGPEKPRRGEAARRVI
RLSDCLRVAEASGEASSPRDTSAFFLETKERQYQLAAPASERSDWIQAICLLAFPGQRKE
LLGPTGKGSRPRMEENELYSSTTAVAPRKEFVVTMRPTEASERCRLRGSYTLRAGETALE
LWGGHELGSKLYEWPYRFLRRFGRDKVTFSFEAGRRCISGEGNFEFETRQGNEIFSALEE
AISAQKNSTHPGPPSQPATVPAVLPRPESPYSRPHDSLPPPSPSTPVPSARPRGPEGEYA
VPFDAVARNLGKSLRGVLAVPPHVPADPLYDSIEEHLPPRPDHIYDEPEGVAALSLYDSP
QEPQGEAWRRQATADRDRGLQRGQDLSAAGWPQGTEYDNVILKKGPK
Download sequence
Identical sequences M3XYR4
XP_004763382.1.14098 ENSMPUP00000004215 ENSMPUP00000004215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]