SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004217 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004217
Domain Number 1 Region: 54-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000922
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004217   Gene: ENSMPUG00000004252   Transcript: ENSMPUT00000004293
Sequence length 217
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897080.1:551411:775627:-1 gene:ENSMPUG00000004252 transcript:ENSMPUT00000004293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKV
TYLGKVPTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFKKTFHSMKSDGRIHRNSSSEEVSQELESDDG
Download sequence
Identical sequences M3XYR6
ENSMPUP00000004217 XP_004427712.1.5094 XP_005635856.1.84170 XP_006207976.1.17985 XP_019512660.1.44202 ENSMPUP00000004217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]