SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004244 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004244
Domain Number - Region: 90-236,266-320
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0596
Family BAR domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004244   Gene: ENSMPUG00000004278   Transcript: ENSMPUT00000004320
Sequence length 430
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897049.1:3317896:3370558:1 gene:ENSMPUG00000004278 transcript:ENSMPUT00000004320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFKKVKSTKNKARKSSIMSSDTDVNKSASPTAEEQPKETDGPLPGSVNDQEKKVRFSPA
TMSTKNSTDLVQYVDKGHSFLPVIPNTQRSQLEDRLNNQERTITFLLEQAFRIKEDISAC
LQGTHGFQKEELLARKLLENHIQTITSIVKKLSQNIEVLEDQIRARDQVATGTNFAVQEL
NTKHIQGVGDLRGRVARCDSSIVKLSGDIHFIRHEHRKTEKTIQDFMSALETVSKNLDVK
VMQLLGKIEASSSEQISNLKMVQGDHRHEMNLLEFKFNSLSNNLYEEVENHQKWTESRFI
TYEKDHLGHINQCLKLLQEKLEKSENKMEEKLLKLSSKLENLINTEKQEGGLSKVKHIEN
KLSKKMNQLEKHIWGELEKMQSEYQSGFQSIHDSLSSLQQIQKTKMDLEKYKVQKDLKKL
QRKIVELQEV
Download sequence
Identical sequences M3XYU3
ENSMPUP00000004244 ENSMPUP00000004244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]