SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004250 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004250
Domain Number 1 Region: 461-549
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000229
Family Synaptotagmin-like (S variant) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004250   Gene: ENSMPUG00000004284   Transcript: ENSMPUT00000004326
Sequence length 602
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897046.1:4129817:4135263:1 gene:ENSMPUG00000004284 transcript:ENSMPUT00000004326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVVSLLGADSTISGASPVGRECLCRASAHKTPASRVQTLPCLRSSMGAHLFLLGLLLL
LLPTPTPAPCRTGTRNECRRNQEFVPGAALAGEGVDVTSLQRSGSFPVDVESYLRPDRTC
TLCQNALQAGALQRLPLALTHWRAQGSGCQRQVVRAKATSTEGVAREAASHIRNDWQVGL
DVSPKPSAQVHVTMAGSHSKMANFAAQKTHQDQFSFSTDLVECRFYSFHVVHSPPLHPNF
QKALSDLPPDFNTSTEAEYVRLISNYGTHFIRSMELGGRVSALTALRTCELALNGLTAKE
VEDCLNVEAQVSINSQARLSSKFKACEEKKKQHKMESSFHQSYRERSSQIVGGHHTTVSD
LLFGDGAKPEQFSAWMNSLLDRPGLVDYTLEPLHVLVESRDPRREALRQAVSKYVMDKAR
WKDCGRPCPPGQYKSPHNPCQCVCHSSAVINQDCCPRQRGLAHLEVMNFQATGLWGDYIT
ATDAYLKVFFGNQELRTSTVWNSNYPKWAVRLDFGDVILSTGGPLRVQVWDEDYGWDDDL
LGTCDQKTQSGSHEVTCNLNHGHLSFSYHAKCLPHLEGATCLQYAPHGLLGAPPGNRSGP
VW
Download sequence
Identical sequences M3XYU9
XP_004769571.2.14098 ENSMPUP00000004250 ENSMPUP00000004250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]