SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004251 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004251
Domain Number 1 Region: 152-434
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-77
Family Nuclear receptor ligand-binding domain 0.00000000168
Further Details:      
 
Domain Number 2 Region: 102-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.35e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004251   Gene: ENSMPUG00000004285   Transcript: ENSMPUT00000004327
Sequence length 435
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896927.1:8573434:9012802:1 gene:ENSMPUG00000004285 transcript:ENSMPUT00000004327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPP
LYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK
ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE
LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIE
DGEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK
VPMHKLFLEMLEAKV
Download sequence
Identical sequences M3XYV0
ENSMPUP00000004251 ENSMPUP00000004251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]