SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004260 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004260
Domain Number 1 Region: 29-221
Classification Level Classification E-value
Superfamily PRTase-like 3.36e-44
Family Phosphoribosyltransferases (PRTases) 0.00061
Further Details:      
 
Domain Number 2 Region: 254-441
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.13e-37
Family Decarboxylase 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004260   Gene: ENSMPUG00000004294   Transcript: ENSMPUT00000004336
Sequence length 446
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:16164333:16181850:-1 gene:ENSMPUG00000004294 transcript:ENSMPUT00000004336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKPDAPWSLEQARERVEMAAAEAALGSLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGI
VSRPRLLSQVADILFQTAQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDY
GTKRLVEGAVNPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGRDKL
QAHGIHLHSVCTLSKMLEILEQQKKIDAEMVERVKRFIQENVFVAANPNDSLIPINKAPG
ELSFGARAELPRIHPVAAKLLRLMQKKETNLCLSADILESRELLQLADALGPRICILKTH
VDILNDFTLDVMKELTALAKRHEFLVFEDRKFADIGNTVKKQYEGSGVFKIASWADLVNA
HVVPGSGVVRGLSEVGLPLQRGCLLIAEMSSAGSLATGSYTKAAVRMAEENPEFVLGFIS
GSRVSMKPEFLHLTPGVQLEAGGKSI
Download sequence
Identical sequences M3XYV9
ENSMPUP00000004260 ENSMPUP00000004260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]