SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004283 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004283
Domain Number 1 Region: 150-212
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004283   Gene: ENSMPUG00000004316   Transcript: ENSMPUT00000004359
Sequence length 279
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:1466868:1468631:1 gene:ENSMPUG00000004316 transcript:ENSMPUT00000004359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPKVKEMGHQGSSPPRLPPGVP
VISLGHTRPPGVTMATTELSALRPPLLQLSALGTVPPPLALHYHPDPFLNSLYIGPAGAF
GLFPSSRLKRRPSHCELELAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHP
PDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPAPSGPRKRPAHRGPIDGARRGPCR
RAEAAVRSQPATPAGPDGSPDGAARPIKTERAAVSPEVR
Download sequence
Identical sequences M3XYY2
ENSMPUP00000004283 ENSMPUP00000004283 XP_004748364.1.14098 XP_004748365.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]