SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004290 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004290
Domain Number 1 Region: 36-96,127-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.21e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004290   Gene: ENSMPUG00000004323   Transcript: ENSMPUT00000004366
Sequence length 692
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:4726414:4755102:-1 gene:ENSMPUG00000004323 transcript:ENSMPUT00000004366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLRGCGPCVAASFTKKHLPLLRFIGDSAAPLSTNFDVVVIGGGHAGTEAAAAAARCGS
RTLLLTHRVDTIGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGP
AVWGLRAQIDRKLYKQNMQKEILNTPLLTVQEGAVEDLILTEPEPEHTGKCRVSGVVLAD
GSTVHAESVVLTTGTFLRGVIVIGLETHPAGRLGDQPSIGLAQTLEKLGFVVGRLKTGTP
PRIAKESINFSILNKQTPDNPSIPFSFINETVWIKPEDQLPCYLTHTNPRVDEIVLENLH
LNSHIKETTRGPRYCPSIESKVLRFPNRLHQIWLEPEGMDSDLIYPQGLSVTLPAELQEK
MITCIKGLEKAKMIQPGYGVQYDYLDPRQITPSLETHLVQRLFFAGQINGTTGYEEAAAQ
GVIAGINASLRVKRKPPFVISRTEGYIGVLIDDLTTLGTNEPYRMFTSRAEFRLSLRPDN
ADSRLTFRGYKEVGCVSQQRYERASRMKTSLEEGISVLKSIEFSSSKWKKLIPEASISIG
KSLPLRALDVLKYEEVDMKLLAKAVPEPLKKYIKCRELAERLKIEATYESVLFHQQQQIK
EVQRDEALQLPKDLDYLTLRDVSLSYEVREKLQFSRPETIGAASRIPGVTPAAIINLLRF
VKTSQQRQMAVHELPRTDQSLCDTDRLEERQL
Download sequence
Identical sequences M3XYY9
XP_004770784.1.14098 ENSMPUP00000004290 ENSMPUP00000004290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]