SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004361 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004361
Domain Number 1 Region: 19-135
Classification Level Classification E-value
Superfamily PH domain-like 7.6e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000144
Further Details:      
 
Domain Number 2 Region: 777-815
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000471
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004361   Gene: ENSMPUG00000004394   Transcript: ENSMPUT00000004437
Sequence length 817
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896982.1:1214956:1282151:-1 gene:ENSMPUG00000004394 transcript:ENSMPUT00000004437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNLAYFKYLKFASFIFHSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGN
NTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASA
MMHALEVLNSQETAQSKVAATQDSTNLRCIFCVFYLGPTLPRQNSQLPAQVQNGPSQEEL
EIQRRQLQEQQRQKELERERVERAERERLEQEQLEREQRERERQDRLERERLERIDRERE
QRERQERQEQRERQEQREREREQRERQEQLEREQLEWERERRLSAAAPSSDSSLYNAPLP
EYASCQPPSAPPPSYAKVISAPVSEATPDYAVVTALPPTSTPPTPPLRHSATRFAASVGS
AFHPVLPHYATVPRPLNKNSRPSSPVNTPSSQPSAAKPCAWSTSTVSPLPPSPPVMISSP
PGKATGPRPVLPVCVSSPVPPMPPSPTAPNGPLDSVPCPVSPPPTSGPAAPPPPPPLPSL
APRSHCGSQASPPPSTPLASTPSSKPSVLPSPSAAAPASAETPLNSVLGDSSASEPGLQA
ASQPAETPAQQGLVLGPPAPPPPPPLPPGPVPAPAALHPHPGPPPPPPLPAAGPPPPPPP
PPLPNQAPPPPPPPPAPPLPASGFFAGSASEDNRPLTGLAAAIAGAKLRKVSRMEDGSFP
SGGTTVGVNAASLKSDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDK
NEESEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRPKSAPSSQPSANGVQTEGLD
YDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNSA
Download sequence
Identical sequences M3XZ60
ENSMPUP00000004361 ENSMPUP00000004361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]